SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5085.CADAFUAP00006009 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5085.CADAFUAP00006009
Domain Number 1 Region: 50-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000093
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 2 Region: 113-156
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000916
Family Zn2/Cys6 DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5085.CADAFUAP00006009
Sequence length 1062
Comment (Aspergillus fumigatus)
Sequence
MTPEKSDAGQGLTNDMVELANRREAQTGADETSINRAREVRLGSAPGQTKCSICHSTFRR
PEHLKRHFRSHTKEKPFECAQCGRHFSRTDTLHRHELSHHTLGPEGGKDRMHRITVKTFR
ACYKCAVARVRCSGGSPCVRCENRSLECQYPTERRSKAKTRKEVAQNLSSERNSTIYGQA
TQRESPSSPAGADVPGADIREQPRNEPPGFQITEFQLDLPGSHRVDTPSKHMPAEKPHGP
PRGISSEHQNGPPGDETADLNARMLLSDAGGSTHDARVSLPEYASLSSQQFYSQLPAGGA
QTLSQESASQLDHRSRDIQQPVAATSNVNLELEGVGGQQMQLGFDPPFLDQSMLSTLNWL
PNDMFPDTTSDQSLSRMPPLSDQLGILDEPVSRTAWLPPVTNLRQMGPSARENHSHTPSG
HMSVGTDAGSPDRFSHSIGEGSLHSEPSNATKRSGDFYVDGAGARLPKYRRNRTSWSRLS
AEPIELLAPLHQHDTRHQFSFPLTQEIRPDFLPGEEAASNCRIEAPTYDRIYQSFLQLCR
TDNPLFLKFETGNFPSADALSSYVYLYFDSFQPVYPLFHPPTFNPNKCHWLVTLAISAVG
CRFSGLTSLDECTTAFDEFLRRAINIEAMALSCIGLLHSSGCEQSKVSTLNAFGDLVNFT
IREGLLCAVNKPTSQYDDLPLEQKWQDWVEDEIRRRTGYLIWLLDCSLAYYFDNRPLLSS
DDGQCPLPSHENLWNAQSAEAWRDVLERTSGSRGISLYKAVLTIYIEKKLVPGIGEFSHV
LLLHALYHRMWEVGDYFRRPLSFWNPTAKKQTLDTAIPSGSVWLPGIPSYSKWRNSACDC
LDILHWTANSTIAKAAGLEHPTVLHLHAARIVLLAPFREIRSLATSLAMGKIRWSDHQQA
LEWHYILRWIKHDQYKARLAIIHAGTTLWHVRRYSTNAFHEPVAVYLSILTLWAYGSCHA
QIAEEPSSRHGLRHHPVREPTFIHLDRPCDDELVQLFVREGHAMQGNVTGVGDICAPHGP
ERILEVGCETLAGLTSWGISKRFIAILTKLAELSSQPQAPRN
Download sequence
Identical sequences Q4WVG9
XP_753445.1.65241 5085.CADAFUAP00006009 Afu5g12060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]