SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5085.CADAFUAP00007579 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5085.CADAFUAP00007579
Domain Number 1 Region: 21-109,198-432
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.31e-76
Family IF2B-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5085.CADAFUAP00007579
Sequence length 439
Comment (Aspergillus fumigatus)
Sequence
MPTTSAALTPGLASFLKSLKTTPIDTSIDNLISLLKRRQIRHSRSCATATAYLLLRVVSA
CRTTDAAKLIERVQSVGRRLVAAQPREMVVGNIVRRVLGLIRDEAEDERDGDFTLSDAGS
EGQPQTPRVSEDPSDPLSLRHEGSERSSSRPPFTSLATTPISMFNLLSHPEPETSLPGTP
ASASPSGRLLGHAPTRDIRAEVLDGIGEIIDELGQVDDQIAAYALDHIHSNEIILTHTSS
TTVQKFLLKAAAKRKFTVIHAESYPNNHEATHTTVSGAASTDEEILSTDSFQKPLIALGI
TVILIPDSAVFALMSRVNKVILGTHSVLANGGLVAAAGTRVIARAAKVHQTPVVVVSGVY
KLSPVYPFDFESLIEYGDASKVIPYEDGDLMDQVDVQNPLYDYVPPELVDLYITNLGGHA
PSYLYRIVSDHYRKEDINF
Download sequence
Identical sequences A0A229XSW1 B0XQ67 Q4WTF8
Afu1g09450 Afum_A1163:AFUB_008900.t1 5085.CADAFUAP00007579 XP_752312.1.65241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]