SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5085.CADAFUAP00007608 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5085.CADAFUAP00007608
Domain Number 1 Region: 20-68
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000414
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 92-130
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000301
Family Zn2/Cys6 DNA-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  5085.CADAFUAP00007608
Domain Number - Region: 620-656
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 0.0353
Family Nqo1C-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5085.CADAFUAP00007608
Sequence length 866
Comment (Aspergillus fumigatus)
Sequence
MITPQSQPDSVPEGNLVPRNLYQCGTCSQSYSRIDHLRRHILSHTQEKPHQCSVCSKRFG
RIDLLRRHSALHITPGSKQILKKRPRSGSANLISRASQACSACAENHLRCDEEKPCARCR
RRNIACVVPSKTTDGVQVRFANPDSPGSEEINSNQTSEESRGETDTLLSEGSQPLITPPM
EIPASQEPDHSQLIDLGGNSHMPPDCIPSGPRDEFTSGLFTDAPSGVRTPRGSITFGLQT
DLDFSMVDLSFLESYNSHVPFEFDEQAPSLSLSGSPYEARETPIERNPRGTRSMQRLRWR
FVPDPQDHGYCEHENLLLPNEATGASSLTPESPEDAHSQSTTDQSLDFHSRDKILGIVLS
QMKQPIPAVLSSFPSAQLLDSLIRYYLTAPFSTANTWIHRATFRPRQVCPELLLAMAAAG
AVLTPDPSLRKLGFAMQEVVRLQLPSVFERNNTTIRDLHLHQAYLLYLEIGLWSGNSRKI
EISEAFRQPLLTMVRRGGNFHHSAYPPLPARLEESGRSLEDTWRAWVYKEAYKRLVYRLF
RLEAQVSMALFTSPLVTYVEMGPPLPAPAYLWEASSASQWKDAYHSSPLPSTGRIRTLNE
CVANLDLLETSRRVADIRLACGAVMHCIWGLVWEFRQLSSLLNGHSRYWDNDLLMVARHG
QLSRILECFRIGYRDEVPVQLHFVMMHMYVSLEEVETLATSDDAGRAWEQPALSDWFKSE
HCRHAIWHAGQVVRGIKCLPLQGLRDFMAIALYHASLTLWTYGVVFFHNMDNQSQQLAGP
TLQQKVWLDGLECEDIQRFITLHRGIPVLQGLGHAEETVFVGDPQSVLETMIKVMQQNHH
HETSKQTPPLVDNLVHLLEKLRDASK
Download sequence
Identical sequences Q4WR40
XP_753130.1.65241 Afu1g17640 5085.CADAFUAP00007608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]