SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 512566.SPG_1324 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  512566.SPG_1324
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 6.28e-36
Family At5g01750-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 512566.SPG_1324
Sequence length 161
Comment (Streptococcus pneumoniae G54)
Sequence
MKTFLVKQKFRLGGERFAIKDDRGEIAYQVEGSFFKIPKTFTIYDAAGEQVSEISKEILT
LLPRFEIQLRDGSSFVIRKKLTFWRDKYEFDNXGLRIEGNIWDLNFKLLDDRDQLIAEIK
KELFHLTSTYTVTVLEDAYADLVISLCVAIDYVEMLESQSH
Download sequence
Identical sequences gi|194398166|ref|YP_002038031.1| 512566.SPG_1324 WP_000847055.1.69591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]