SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5141.NCU02853.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5141.NCU02853.1
Domain Number 1 Region: 7-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000176
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 2 Region: 68-102
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000127
Family Zn2/Cys6 DNA-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  5141.NCU02853.1
Domain Number - Region: 481-554
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000471
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5141.NCU02853.1
Sequence length 993
Comment (Neurospora crassa)
Sequence
MSEAAPVHRCPVCYKTYKRREHLQRHRASHTSERPHRCILCSASFQRTDVLKRHIQTCDG
LPHGSSGRRRACDRCVRQKKACNSAQPCQNCSKRAVQCLYSSVGSSSTSQDGEAGSTSAA
NSVESFSNTPSTQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPQQQQQQQQQT
QQYQHQQFLHQQPQQLHQQQQQQQQEQQQQQQRQQQRQQQQQQQHQQQHQQQHQQQHQQQ
HQQQHQQQHQQQQHQPIYLQQQHQYQHQQYHHHQQQQQQQQHPQRPPHHQFQPQQHQQQT
YQQHPHQQQHNQQQRHHHNVLHAQVTQPLTQIPQIAPVPVPQIPRNHQVPVPQILQQSHQ
SHQPHSAHQPHHVPFHHPGVAHFDDLDNLLQDAAGQFPMLGHQDTHIPDWIEMELPMGTH
AMDTPEGNTTSRSTPSSETHRGYSFDFLYDFTSRTGLVDSFECGTHAQRRAVVDAFYASY
AEQQKHHQQLQQIQQQQQQQQQHLKAQQQIQGQLEFHPMFPQLQHHMGQPPLSPASSSAV
SISATSNDYSYMPWTPWSSWLSNPIIIKLQEIVVSIMNVVRHKPSNSTLGTLTWTPDKEQ
ECLQFFSPQRFAKFLELFWSCWHPNVNFMHRPSFDPTSAKPTLLAAMALTGNDTEPGSPA
DDDANPASALHCKRKLQALQASYIVCLYQNWEGSDASKRRIRRHRFNTVVSVARDIGIPM
AKHLEYGRLLRHEFDWHEYVVREELIRTFLWVFLLDTAFVIFNNLPHRMVIKEMRMHMAS
PEAVFQAPTAEKCLEEIYQWMPSSSPICNTLLRDVLENVIGTTLDADTLQRLARLGPLNL
FVVVSVFHYMIFQHQNLFGVEGQLVPIRNGLDNWITIWELWCDHWSSTPPHCMAASDNLT
PANMWKRIGFIRCSAEYWLLGSLLTDRIARKTSGGVRENQGKGSSPDSYPDELTGSGKGK
SNDPILIKYDQTSMRQVNELISDFKKIQLEEIE
Download sequence
Identical sequences Q6MVR6
5141.NCU02853.1 NCU02853T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]