SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 51453.JGI76451 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51453.JGI76451
Domain Number 1 Region: 969-1097,1221-1289
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.4e-26
Family Haloperoxidase 0.058
Further Details:      
 
Domain Number 2 Region: 38-90
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000147
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 3 Region: 109-149
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000157
Family Zn2/Cys6 DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 51453.JGI76451
Sequence length 1293
Comment (Trichoderma reesei)
Sequence
MEAIPSPTSPSSAADSTATAGTTGRATPEPGSASRKSHQTSNPYACRDCGRTYSRPEHLV
RHVQTHTLGRRFACEICKKSFARKDLLRRHVANHENDSPKKRQRLLSSPNSSRVTQACRA
CAAARVKCDESKPCRRCVSRNLPCSSYEASTSGSLVHLPASGPDAADARPSGEWFTASTD
SKPASHSSVPSASANFRTPYLGSTTASTHGPAQPNDASSKAASGLMELSNTPFFDFLRDV
LYQQPVDLSRTHESQGPAVLDFCDDMDMDLTDMDFGLLDHWNLDLNDGSAMVTPAMASQT
TQNSTEMSQMRQNLANVWGELPWKWEPTNKDNAYTEQGNLPISSKDISNAQFQETKRQLE
RVVDQKLNLSSRDQILAIVLKTCRDASTASRVAASFPTVDVMDTMAQAFLAAHVRQVSTW
IHYPTLKLNAVWPEWIGNAVAAGAVLMPAPTLRKFGFAVQEAVRITIPSRFEDNNTAIQN
LSLVQSLILGQDIGLWSGNRRKMEIAECHLVIPVTMMRYRRMFQRCMYPAITVSASDEGD
VLEQKWLKWAAAEQWKRLVFHCYIREAQLSMTALTNPCMSYSELTLPLPERKALWCAKSA
SEWKAVYLAGAAGQNTKIPSLAEMYRDARRFVENSTRIDMQLSVSVYLHGFWSMIWEYSQ
LSVVHQFRSYSKEGSNALLSSRREELTRELQAFQFVASELEGISPQEQVILYLLMMHLHV
SLDDLQIFSGKQGEEEARRMYPILQQWTASPDSWYAVWCAGQVLRYAKLFSPGTLKDFYA
IAVHHAALALWTYGVVSRASQQQDMPSQYDYDAMYLDDGGDATSLRQFLSFGQGRPFIQG
LAGSSSGAAPGDASVYDPRACMDIAQEILQANFRRPQDALPPLVENLCQLIKQLGNAAWA
VGLGNSRVLTTAMAVTVTTTAVATATLLLLVRSALWPRWGKVLPNPLKTADKVKVEGLVY
RPDAFPGARDVETPYGSIRVYEFGPEDGEKVLLVHGISTPCITLSHIAHGLVARGCRVML
FDLFGRGFSDGVGDLAHDERLYTTQILLVLASSPLPWTGTNAIRLVGYSLGGGIAVHFAT
AFPHLVSSLVLLAPAGLINPEDFGAVSLFVFKSGFVPERILAYLTRLRLQKPIAAARKPK
EPPSSSSPTSAVADIAIPEATSTAEQNTSSSSSSSTDGTATRIPLEQHVLMYVRWMVLNH
PGFVPSFMSCIRHAPLTHQHESWQLLARRKAGTTIVLLARDDELIDVGDYEREALPLVGG
KENVVWKVLPGAHDFVMTHTEHILRELDELWKM
Download sequence
Identical sequences G0RF55
XP_006963728.1.9351 jgi|Trire2|76451|estExt_GeneWisePlus.C_50528 51453.JGI76451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]