SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 515619.EUBREC_0260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515619.EUBREC_0260
Domain Number 1 Region: 443-549
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000765
Family Anti-sigma factor antagonist SpoIIaa 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 515619.EUBREC_0260
Sequence length 712
Comment (Eubacterium rectale ATCC 33656)
Sequence
MKQKLSVAPTLKNYDKKNLPKDILAGIIIMAVSIPISMGYAQISGLPAVYGLYGSVFPII
LFALFSTSPQFIFGVDAAPAALVGAAVLGMGIEAGSKEAMTVVPVFTFFVALWLLAFYFM
NAGKLVNYISAPVMGGFITGICTTIILMQAPKLMGSAAGTGELFELSEHIWEALHHINAA
ALVMGIVALAILVVSKRLVPKFPMAVVLMVTGALFTYFGPVKEWGVPTLSAVEPGMPRWY
IPDFEAVFSVQKASEVIVLSLSVAVVIMAETLLAENNFAQKNGYRIDDNTELLAFSIGNM
AAAFTGCCPINGSVSRTAMSEQYEGKTQLTGLVAGVSMIAVLLFCTGFIGYLPVPVLTAI
VISALMGATEFHLAKRLWKVSRTEFFIFVGAFFGVLILGTINGVLIGIILSFAEMIIRSA
KPATCFLGVQPGHSHFRDIRESTNIHEIDGVIIYRFSSGLFFANAKVLVRDIEDHLKHDT
KAVIIDAGAIGSIDITGADSIESLYRSLKQKGVKLYITEHIAELNEQLRKLGLGYLIEQG
CVRRTIHIALKDMGINRPYPLEGGVDNEERSASRKRADNRVQEFVWAFGAESEEQIEKQI
KLQIEQLKKTKDIEEIMHGRWAHMDEFDQDEWLEHLEEHLKEIVNISGKDVHTLAADIEM
HRREVHERIAREHPELAERFAQRRHLLDKHLKERRPEVYRIIVQLREDNKHK
Download sequence
Identical sequences A0A173UUX4 A0A173VHG9 A0A1Q6PJR0 C4ZAK3
WP_012741185.1.21182 WP_012741185.1.32465 gi|238922685|ref|YP_002936198.1| 515619.EUBREC_0260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]