SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 515620.EUBELI_00158 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515620.EUBELI_00158
Domain Number 1 Region: 24-156
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.00000000000000589
Family Regulatory protein AraC 0.017
Further Details:      
 
Domain Number 2 Region: 225-274
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000175
Family AraC type transcriptional activator 0.022
Further Details:      
 
Domain Number 3 Region: 171-223
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000152
Family AraC type transcriptional activator 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 515620.EUBELI_00158
Sequence length 277
Comment (Eubacterium eligens ATCC 27750)
Sequence
MFQDMSKDFDIKRIKRSNTSCSTGVGAHVHPFNEIFYLSSGECTSFIDHNIYKFGKGDLV
IVPSGCLHRTTYNGKGMHERIVISFRNEATEWIQNQTGKELMENCMKPGVVNIPEKRRDY
VVALLDKLIFENDSPDELSPAFIKVGLIELLLFIIRCKNYEENVIKEIDVDNRIIQEVAT
YIYEHYADNLSLEYVADKFNLSRSYLSKKFKTATGFGFKEYIINVRIQNACNLLLETNKS
ITDIAFECGFNDSNYFGDAFRKAKGISPHKYRKNETF
Download sequence
Identical sequences C4Z204
WP_012738432.1.74791 gi|238916124|ref|YP_002929641.1| 515620.EUBELI_00158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]