SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 515620.EUBELI_00900 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515620.EUBELI_00900
Domain Number 1 Region: 30-171
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.44e-44
Family Ribonuclease PH domain 1-like 0.0000272
Further Details:      
 
Domain Number 2 Region: 319-516
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.32e-43
Family Ribonuclease PH domain 1-like 0.00000846
Further Details:      
 
Domain Number 3 Region: 167-257
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.8e-24
Family Ribonuclease PH domain 2-like 0.0049
Further Details:      
 
Domain Number 4 Region: 477-576
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.86e-22
Family Ribonuclease PH domain 2-like 0.00015
Further Details:      
 
Domain Number 5 Region: 638-722
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.97e-20
Family Cold shock DNA-binding domain-like 0.00094
Further Details:      
 
Domain Number 6 Region: 582-659
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000259
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 515620.EUBELI_00900
Sequence length 723
Comment (Eubacterium eligens ATCC 27750)
Sequence
MYIMAVVYGVFFSCFGPSVKYIFFMEGVHMFKQYEMELAGRTLRVDIGRVCAQANGAALM
HYGDTVVLSTATASKEPREGIDFFPLSVEYEEKMYAAGKIPGGFNKREGKASENAILTSR
VIDRPMRPLFPKDYRNDVTLNNMVMSVDENCRPELLAMIGSAIATSISDIPFDGPCATTQ
IGMIDGEFIVNPSQAQWQDGDLQLTVASTKQKVIMIEAGANEIPEDKMIEAIYKAHDINQ
TIIAFIDKIVAEVGKEKHSYVSCAVPAEMFEAMKQVVSPEEMEVAVFTDDKQTREKNIDA
VTEKMKEAFADNEEWLAVLGEAVYQYQKKTVRKMILKDHKRPDGRAINQIRPLAAEVDII
PRVHGSAMFTRGQTQICDVVTLAPLSEAQKVDGLDENVTTKRYIHHYNFPSYSVGETKPS
RGPGRREIGHGALAEKALVPVLPSEEEFPYAIRAVSETFESNGSTSMASTCASCMSLMAA
GVPIKRMVAGISCGLVTGETDDDYIVLTDIQGLEDFFGDMDFKVTGTTEGITAIQMDIKI
HGLTRPIVEEAIRRTREARLFIMDTCMKPAIAEPRKTVGEYAPKIIQTSIDPAKIGEVVG
QRGKTINAIIDECGVKIDITDDGFVSVCGVEQAGMDKAMKYIKTIVEDFEEGKIYEGKVV
SIKEFGAFVEFAPGKEGMVHISKISNERINHVEDVLTLGDHVKCKCMGKDKMGRISFSIK
DAM
Download sequence
Identical sequences C4Z5P3
gi|238916832|ref|YP_002930349.1| 515620.EUBELI_00900 WP_012739138.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]