SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 515620.EUBELI_01119 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515620.EUBELI_01119
Domain Number 1 Region: 316-465
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.46e-29
Family HD domain 0.015
Further Details:      
 
Domain Number 2 Region: 203-299
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.6e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 515620.EUBELI_01119
Sequence length 515
Comment (Eubacterium eligens ATCC 27750)
Sequence
MIPIVIAIIATLVIVAPITWFISSNAINKRNDATIGNANEKAREIIDEALKTAETKKKEA
LLEVKEESLKTKNELEKETKERRAEISKYEKRVLSKEETLDRKIEAVEKRDSNITRKEEE
LGKQKQKVEELEKKRQQELERISGLTSEQAKEYLLKTVEDEVKHDTAVMIKTLESRAKEE
ADKKAKEIVVNAIQRCAADHVAETTISVVQLPNDEMKGRIIGREGRNIRTLETLTGIELI
IDDTPEAVVLSGFDPVRREVARIALEKLILDGRIHPARIEEMVEKAQKEVETLIKEEGEA
ATLEVGVHGIHPELVRLLGKLRFRTSYGQNVLKHSIEVAQLTGLLAGELGLDVKMAKRAG
LLHDIGKAVDHEMEGSHIQLGVDLCRRYKESALVINAVEAHHGDVEPESLIACLVQAADT
ISAARPGARRETLETYTNRLKQLEDITNSFKGVEKSFAIQAGREVRVMVVPEVVSDSDMV
IMARDISKQIEDQMEYPGQIKVSIVRESRAVDYAK
Download sequence
Identical sequences C4Z0K6
515620.EUBELI_01119 gi|238917049|ref|YP_002930566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]