SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 515620.EUBELI_02058 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515620.EUBELI_02058
Domain Number 1 Region: 134-244
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 1.46e-36
Family KorB DNA-binding domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 54-144
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 6.02e-27
Family ParB-like nuclease domain 0.00034
Further Details:      
 
Weak hits

Sequence:  515620.EUBELI_02058
Domain Number - Region: 232-283
Classification Level Classification E-value
Superfamily Outer surface protein C (OspC) 0.0049
Family Outer surface protein C (OspC) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 515620.EUBELI_02058
Sequence length 311
Comment (Eubacterium eligens ATCC 27750)
Sequence
MVTEKKTSKISKSRGLGKGIAALIPEDDGNEDKVVVKEVVKEVVKEVPVPTETKLKISQI
EPNKNQPRKAFDEDALIELSESIKQYGVLQPLLVQKMDKNYQIIAGERRFRAARLAGVKE
VPVIIKDYSSQEVMEIALIENIQREDLNPIEEALAYRQLIKDYRLKQDEVAEKVAKSRTA
ITNSLRLLKLDDRVQEMVIEGKLSSGHARAIIGIEDKEKQYMVALKIFDEKLSVRDVEKL
VKNIDKLDKTVEKKKPENDFVYRDFEEKLKKIMGTQVVIKNKNNNKGKIEIQYYSQAELE
RIYDLLKKVNE
Download sequence
Identical sequences C4Z5D1
515620.EUBELI_02058 gi|238917968|ref|YP_002931485.1| WP_012740270.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]