SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 515620.EUBELI_20100 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515620.EUBELI_20100
Domain Number 1 Region: 11-140
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000023
Family HD domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 515620.EUBELI_20100
Sequence length 200
Comment (Eubacterium eligens ATCC 27750)
Sequence
MEKLNIQTAELALKEASESNPGAWADHSRFVAEACKNIASHCKDLSSEQAYIFGLLHDIG
RYAGVSSERHLIDGYRYCMERGWEKVAQICISHAFMIQDIDTSIGEFDVSYEDYLFMKEF
VANAIYDDYDRLVQLCDALAMPTGFCLLEKRFVDVTIRYGVHPATIDRWKRILEIKEQFE
NQIGCSIYSLLPGIVENSFR
Download sequence
Identical sequences C4Z7G9
515620.EUBELI_20100 gi|238921867|ref|YP_002935381.1|NC_012780 WP_012740381.1.74791 gi|238921867|ref|YP_002935381.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]