SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 515620.EUBELI_20590 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515620.EUBELI_20590
Domain Number 1 Region: 289-601
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.73e-100
Family SCOPe 0.00085
Further Details:      
 
Domain Number 2 Region: 9-144,172-186
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.25e-50
Family SCOPe 0.0015
Further Details:      
 
Domain Number 3 Region: 192-285
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 7.57e-24
Family SCOPe 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 515620.EUBELI_20590
Sequence length 611
Comment (Eubacterium eligens ATCC 27750)
Sequence
MLYPVLTQSRLLSDLSGVWDFKLDNGKGFEEKWYEKPLKDADTMPVPASYNDLKEGTDFR
DHYGWVFYQRNISVPEYVKSQRIVLRCAAVTHYAMIYLNGKLICEHKGGFLPFEVELNDD
LQDGDNLLTIAVNNVIDYTTLPVGGKANMMSGMMGGMGAGASDKPQNNPNFDFFNYCGIT
RPVKIYTTPETYINDITVTADIDFTKEEPSAVLNYNVEIKGKDYNNITCKVELFDEEGTK
LSETEGSEGTFEISNVRLWQPLNAYLYKIKVTAGQDVYTLPYGVRSVRVDGTKFLINEKP
FYFKGYGKHEDTFPNGRGINLPMNTKDISIMKWQHANSFRTSHYPYSEEMMRLCDEEGIV
VIDETTAVGVNLQFGGGANFGGERIGTFDKEHGVQTQEHHKDVIRDLISRDKNHACVVMW
SIANEPDSAAEGAYDYFKPLYDLARELDPQKRPCTLVSVQGTTADTDCSSQLSDVICLNR
YYGWYFGGPDLEVSEIGLRKELSDWGKLGKPVMFTEYGADTVSGLHDTTSVMYTEEYQVE
YYEMNNKVFDEFDFVVGEQAWNFADFATSQSLLRVQGNKKGLFTRDRKPKMVAHYFRNRW
STIPEFGYKTK
Download sequence
Identical sequences C4Z6Z2
gi|238922354|ref|YP_002935868.1|NC_012780 6bo6_A 515620.EUBELI_20590 gi|238922354|ref|YP_002935868.1| WP_012740861.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]