SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 519442.Huta_1005 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  519442.Huta_1005
Domain Number 1 Region: 155-335
Classification Level Classification E-value
Superfamily SGNH hydrolase 4.09e-21
Family TAP-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 519442.Huta_1005
Sequence length 338
Comment (Halorhabdus utahensis DSM 12940)
Sequence
MQLEAFPSVSLHNVAELAPADWTNGGGHLHRVPRDVAANLNVMARDRVQSPTGSEIRFVP
DGDDATVEVTLSAAGETTVQPFWGPFQGAEPFEIGPDPSTHTFSVPDRVRNLDPAAAEDA
AYDTRICRLRFDAWSRVALHDVAGDARPPRDAELPDTRYLAYGTSITEGALSNPHLAYVA
TAARQLGVDPINLGMAGSAYCEPAIADHIAGRDDWDFATIAVSVNMSNRGFTVEQFRESA
DQLLDTVAGAHPEKPIVAVSLFPYHADVVAGDDPERAAAYRETLETLVTESAHDNLSFID
GSKLLSVPGLMDDILHPGDAGMVEIGHNLAEELEPLVE
Download sequence
Identical sequences C7NVA4
gi|257052088|ref|YP_003129921.1| 519442.Huta_1005 WP_015788765.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]