SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 519442.Huta_2094 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  519442.Huta_2094
Domain Number 1 Region: 256-407
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00000000536
Family Galactose oxidase, central domain 0.036
Further Details:      
 
Domain Number 2 Region: 77-316
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00000471
Family DPP6 N-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 519442.Huta_2094
Sequence length 410
Comment (Halorhabdus utahensis DSM 12940)
Sequence
MAGDERTRRGVLGLVGSGALAGMGGCSLVIPEMGPESTVEEDWETVSPQPFTAVAKSRSP
VARFGGPKWTQSFGAALATTGDTVFVGVPGADQGSVENVGAVAVFERAGGDWEQTTTLTG
RGHERGGFGKQVAADGSTLLVGNEYGYSGQPPIPVSVFERSSSDGWQLTTELTDPVYVDS
MAIDGDTAVMKTESGDSHATVFERQDGAWDQQATLRIDPLDDGRTVRRVGKDGETILIGA
PPKSGPKSRRAKAGVVHVFERSAGGWHHQTALSGAPGTDHFGWSVSVDGGRAVIGDYIND
TAYVFSSAGGEWTREQMYTATGGGGHQYFGDTVTIDGETVLVAAYNAQFGDSGGAVYQLD
TDTGAAEPDGTYYTAPDPSRQLGHVIATTDGTTVLTGTHAEEQAVYIYEH
Download sequence
Identical sequences C7NU16
519442.Huta_2094 gi|257053161|ref|YP_003130994.1| WP_015789832.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]