SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 521006.NGK_1001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521006.NGK_1001
Domain Number 1 Region: 25-99
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0000497
Family Duplicated SiR/NiR-like domains 1 and 3 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 521006.NGK_1001
Sequence length 105
Comment (Neisseria gonorrhoeae NCCP11945)
Sequence
MIKYNREEHKMTVQAKTKGLAWQEKPLSDNERLKTESNFLRGTILDDLKDPLTGGFKGDN
FQLIRFHSMYEQDGRDIRTEAKLEPLKFMLLRCRLPAGSSNRPSG
Download sequence
Identical sequences B4RLJ1
gi|194098564|ref|YP_002001626.1| gi|385335694|ref|YP_005889641.1| 521006.NGK_1001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]