SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 521095.Apar_1257 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521095.Apar_1257
Domain Number 1 Region: 4-101
Classification Level Classification E-value
Superfamily PTS system IIB component-like 2.75e-28
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 521095.Apar_1257
Sequence length 104
Comment (Atopobium parvulum DSM 20469)
Sequence
MADYKILLVCSGGISTSLLMKKIEKYAEEHSMDIKVDAVGTASYEDRVSDYDVLLLGPQV
AYRKKQIADSVAIPVAVIAPQDYAFCNVENILKEVDALLGKSNA
Download sequence
Identical sequences C8W892
WP_012809338.1.33702 gi|257785056|ref|YP_003180273.1| 521095.Apar_1257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]