SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 521098.Aaci_2420 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  521098.Aaci_2420
Domain Number - Region: 10-37
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.000356
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.05
Further Details:      
 
Domain Number - Region: 16-98
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0209
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 521098.Aaci_2420
Sequence length 121
Comment (Alicyclobacillus acidocaldarius DSM 446)
Sequence
MPHPLYPIAKQYVGRPVIVHHVNGRRYHGILHSVRDHGIYLLNVRPIAHAAGQNEERFST
LDEAESGDIETVYAPVGYFAFGALTGLTLGTALGATVARPYPYYGYGYGYGYGYGYPGYW
W
Download sequence
Identical sequences C8WSE2
gi|258512382|ref|YP_003185816.1| 521098.Aaci_2420 WP_012811669.1.29831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]