SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 522306.CAP2UW1_4102 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  522306.CAP2UW1_4102
Domain Number 1 Region: 6-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.16e-29
Family Sfri0576-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 522306.CAP2UW1_4102
Sequence length 121
Comment (Candidatus Accumulibacter phosphatis clade IIA UW 1)
Sequence
MIVIEERPRRVDVTVYAEFTLADYQEFENAVNYAIQFEGPVDLFFDLREMADFTLDVAWE
DIVFARAHASDFSRIAVLTHSQWVAWSAWLSQIFVRAEMRIFDDEVEARSWLAAEAGEAS
A
Download sequence
Identical sequences C7RNF8
2000189480 WP_015768506.1.47741 2000468790 522306.CAP2UW1_4102 2001009680 gi|257095632|ref|YP_003169273.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]