SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 525903.Taci_1169 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525903.Taci_1169
Domain Number 1 Region: 83-176
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.84e-36
Family Ribosomal protein L6 0.0000305
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 5.65e-26
Family Ribosomal protein L6 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 525903.Taci_1169
Sequence length 179
Comment (Thermanaerovibrio acidaminovorans DSM 6589)
Sequence
MSRIGRKPIPLPKGVTVTVNGGDVTVKGPKGSLDFKVLPGISVEVKEDQVMVSRSSDEKA
MRAAHGMTRAIINNMVVGVSQGFEKQLEIIGVGYRAQMQGKNLVLSLGFSHPVEVVPPAG
IELAIDGPTKIFVRGIDRQKVGQMAAQIRGYRPPEPYKGKGIRYVGEYVMRKAGKAGSK
Download sequence
Identical sequences D1B5W0
525903.Taci_1169 YP_003317683.1.71145 gi|269792779|ref|YP_003317683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]