SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 525904.Tter_0055 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525904.Tter_0055
Domain Number 1 Region: 140-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.12e-128
Family Enolase 0.0000000436
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.05e-52
Family Enolase N-terminal domain-like 0.00000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 525904.Tter_0055
Sequence length 431
Comment (Thermobaculum terrenum ATCC BAA 798)
Sequence
MAVIDDVYALEILDSRGNPTIQVTVVLDSGAYGTAAVPSGASTGAHEAIELRDKDPIRFG
GKGVLKAVSNVNEIIAETILGENVNSQRELDQILLELDGTPNKSNLGANAILGVSLAFAH
AMAADLNLPLYMYLGGAIARTLPVPMMNILNGGKHADNSTDMQEFMIMPIGASSFSEALR
WGSEVYHALKKDLDNRGFNTNIGDEGGFAPSLDSNKTAIEAILRAIENAGYTPGEQIVIA
LDPAATELYQGGQYHLKKEGEVLTSSEMVDFWQEWIRQYPIVSIEDGLAEDDWEGWTQLT
EAIGNSVQLVGDDLFVTNTDRIREGIARRAANSVLIKPNQIGTLTETIEAVELAHKAGWT
AIMSHRSGETEDTTIADLAVALGTGQIKTGAPARGERTAKYNRLLRIEHELGDDAIYAGW
SALRRKDLLSR
Download sequence
Identical sequences D1CDH2
WP_012874013.1.85100 gi|269925177|ref|YP_003321800.1| 525904.Tter_0055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]