SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 525904.Tter_1119 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  525904.Tter_1119
Domain Number - Region: 39-131
Classification Level Classification E-value
Superfamily E set domains 0.0197
Family Filamin repeat (rod domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 525904.Tter_1119
Sequence length 218
Comment (Thermobaculum terrenum ATCC BAA 798)
Sequence
MSRVMLTLRVFASILLIVLFMSGVAGAHEHRQVGKYELVVGFQNEPAYVGEPNGIWIQVT
EAKNQGDQSNNQESDEHEETGKPVKGLEKTLKAEVIQGNSRMQVPLSPAWNQPGVYVGNF
IPTVAGDYKFHFTGSINGQNIDETFESGPNRFSPVEDVTAIQFPIKTGSPEQISSELEQA
RSTANQSRILGVAGVVIGAIGLAVGLVALAGRRRYSKI
Download sequence
Identical sequences D1CB69
WP_012875069.1.85100 gi|269926233|ref|YP_003322856.1| 525904.Tter_1119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]