SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 526218.Sterm_0739 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  526218.Sterm_0739
Domain Number 1 Region: 1-304
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.83e-60
Family ADP-ribosylglycohydrolase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 526218.Sterm_0739
Sequence length 308
Comment (Sebaldella termitidis ATCC 33386)
Sequence
MREKMKSGIYGYLIGDAVGVPYEFCTSEKLRRLEKIDMIPPKKFNRSHKEVKPGTWSDDG
AQMLCMFASLMECRSFNVNNLAKKLLAWYEKGYMAVNQKVFDVGVQTSRSLIEYSKTKNP
LTSGLVVKNGRGNGSLMRVFPLGLYNSEHGEDKIVEYAHLQSMITHGDIVPQICCAFYSL
WVRETAKGGSIKESYERSADKLMKIYDGQTEYLYYLNERLRPLDYNIKGKGTGYVLDTLR
SVRDVLFEHNNYRDVIINAVLLGNDTDTVAAIAGGIAGVHYGYEAIPEDWLRLLKGKNIV
EKLLANYS
Download sequence
Identical sequences D1AQ33
WP_012860207.1.35130 gi|269119365|ref|YP_003307542.1| 526218.Sterm_0739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]