SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 526218.Sterm_3768 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  526218.Sterm_3768
Domain Number 1 Region: 1-242
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.81e-79
Family LplA-like 0.000000303
Further Details:      
 
Domain Number 2 Region: 243-328
Classification Level Classification E-value
Superfamily SufE/NifU 1.67e-20
Family SP1160 C-terminal domain-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 526218.Sterm_3768
Sequence length 329
Comment (Sebaldella termitidis ATCC 33386)
Sequence
MKYIINENNNPRYNLALEEYVLKNLDGEYFFLWQNEPTIVIGKHQNTISEINLDYVEKKG
IHVVRRMSGGGAVYHDLGNINFSFIQEKKDLADFDFSFFTRPIVDLLGELGIKAEFNSRN
DLAIDGKKFSGNAQYIFKKKILHHGTLLFNSEMEELVNSLKVSKDKIESKGLKSIKSRVA
NIKDYIGEDSKIKEVSDFKVALFEHMKNRMEEFEEYVLTENDKKEIEKLKKEKYDKWEWN
YGESPEADIHRQRKYTAGKVESYIKLKDGLIENIKLYGDFFSSREIEDLESGLKGKKYMI
SEIAEYLKTVNVSEYFSGFSEEEILDVII
Download sequence
Identical sequences D1ARW6
526218.Sterm_3768 gi|269122356|ref|YP_003310533.1| WP_012863184.1.35130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]