SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 526226.Gbro_0080 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  526226.Gbro_0080
Domain Number 1 Region: 4-308
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.24e-108
Family Glutaminase 0.00000307
Further Details:      
 
Domain Number 2 Region: 319-396
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000628
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 526226.Gbro_0080
Sequence length 422
Comment (Gordonia bronchialis DSM 43247)
Sequence
MRSPVPDYLQEVLDDLAHNRDGVVADYIPELAAADPDVFGIALTTVDGRTHVAGDADLAF
SIQSISKPFAYAAAIIDRGLEAVEAKVGVEPSGEAFNELSLEGETRRPKNPMINAGAITA
HHLLVGAAARPEERVERARSFFSELAGRDLGIDESVFSSELDTADRNLSIAHMLRNYGII
DAPAHDVVEGYTRQCSIEVTVRDLSLMGATLANGGVHPCSGRRVLSRAVARQTMSVMAGC
GMYDAAGRWLTTVGIPAKSGVAGGLLGALPGQCGIAVLSPRLDDHGNSVRGVEAFRRMSA
DMGMHLVDAEPYDATVVRDVYVVDDATVFVIQGTIQFGGAESILHAFESDDTATPAAVVD
ATRIDHLSDVGRRMLLEGLRRLRLDGRRVVLVDPDTVLPEPDLDHDGMRPDAVVDDLTMI
GG
Download sequence
Identical sequences D0LAA3
WP_012832024.1.40537 526226.Gbro_0080 gi|262200117|ref|YP_003271325.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]