SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5270.UM03403.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5270.UM03403.1
Domain Number 1 Region: 97-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000237
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 2 Region: 169-212
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000667
Family Zn2/Cys6 DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5270.UM03403.1
Sequence length 1248
Comment (Ustilago maydis)
Sequence
MLVQLGLFTICLSHLEFVASAMVLAVAAPHKRRRLHSSPFDTEDNDDDQVGTSRSPSPAA
DAQPVLHMISSHHQHPSANPLNHATAATASSAASPKHQCDICQKTFVRHEHMLRHRASHT
DTASYSCDHCGKLFRRSDVLHRHRRLHAARRDLMLNVNSSKLTKRQRSALARVEAACLRC
SSKKLKCDAVRPSCSRCLRKSGVVCVYPSSSSEVSPPSPISRNRSVSILDDVWMPDSSTT
LEFSTNDPHSPVPTSMHQYPAQPQVLTPAKFSTADSSIDSSAHAVRSAQTSQPPYPRSKG
SFNADSFPAAMMPASTYFSTNGASSTPSSYHQTASPSVENSIVDNHVIGATPGLIDMIQN
TASSLPSTDVIDERMLSDLLGWLDGHKAPDTAHSGQIDWIFGDSPEAPQLLDWSQMQDWA
NFDLAPLSADAVASNIHQIESMPPHRQQQLAPVHQRDASVDGSAPHHSPLFVLSSAAELI
HAPSRTPQTRLQQLAPPRPSAQPQTQTASRPESIDNVHASAGTDSRTIAEGRSRWNSPEL
ADDDTAPSDSTRSDPLGTRRKTDTVPSSDRTSNIELPSNAARNEKSTSGRRAAAIEAWPN
RWNPTIKVNSLPSFSFVKASEEHLMAEDMAHVKRVSHAAMLRMAEYLRNAAIDSLEQQRF
DDTFATLDAATLNVYLQLFFHHCYSYLPAIHQVTFHPDRCDPRLLAALCAIGAFFSEVPG
SRNAGIYLASLVQMSVSRATLSNNALARVTSTFQSILLIYMLWRSVGVPSRQEYAEAFRG
TYCTMIRRCRLLEDISPPRLPADVTLEDRWTAWVAWESGRRTAWSTLVSETELSIHWNLP
EPFAPDELTGKLPCDDRLWEAPSAIEWAQTAIFLSSASRVFEGEGSLLPQPVHQNDVSNF
TWPDNSYQLDVTWVCDVIQRTAQSLPQGRPSSVTEAEREAIARLSPFNRLCVGSAVMLST
HHTMKMVRFCSMLLGDEEQAKERMRRYLAAATDLLSLNQARDARVDLLLHAIQLFELVSP
EMLQVLSCRRGVPRMYAARQRISRELNQAKPWKTALIVFHAGQMLRLAKQSLQRAPVECL
HIFYAAIALHAVSVLVLQQDALAPPGQIVRIAFNGPARSTAPQAPSTHAGYEATVGQTRA
WRAGSSASGASSTSPSSVGGGSPYSTSGTSITGTTPSDGRQSTGLGRKTTFMLESVGNLA
HPMAPEKLLSLASKWLRADDGVGVWPIGQSLAKILDLLTTLTPKQAGA
Download sequence
Identical sequences 5270.UM03403.1 UM03403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]