SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 546414.Deide_1p00470 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  546414.Deide_1p00470
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.22e-56
Family Methylesterase CheB, C-terminal domain 0.0000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 546414.Deide_1p00470
Sequence length 346
Comment (Deinococcus deserti VCD115)
Sequence
MTDFPLVVIGASAGGVSALMKLCAQLPSSFPAAVLVVQHVSPAHPSMLPRILSAAGTLHA
IHPRDGQTLHPGMIYVAPPDHHLLVDGETVLLSRGPRENRSRPAIDVLFRSAAVEAGSRV
IGVVLTGNLDDGTSGLHVIKQAGGLAVVQDPDDAEFASMPRSALNAVKVDHVAPLSELGA
LLASLVDDRARNHRPTPLASEDVRRLEVELGVAREEHALSKGVTRLGAPSPLTCPECHGT
LIEIREGTLVRFRCHSGHAYTAGTLLTEVSESVESKAYQALRALGETVILLRQLSDQRQK
QGDPAGAEAFLARAREVEASSEGIRALVRTTRALSVEKVERPDFDG
Download sequence
Identical sequences C1D207
546414.Deide_1p00470 WP_012694570.1.1337 gi|226357461|ref|YP_002787200.1|NC_012527 gi|226357461|ref|YP_002787200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]