SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 550537.SEN0243 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  550537.SEN0243
Domain Number 1 Region: 2-200
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.49e-51
Family PP-loop ATPase 0.0000000639
Further Details:      
 
Domain Number 2 Region: 291-401
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.28e-32
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.00000532
Further Details:      
 
Domain Number 3 Region: 201-286
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 5.89e-28
Family MesJ substrate recognition domain-like 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 550537.SEN0243
Sequence length 403
Comment (Salmonella enterica serovar Enteritidis P125109)
Sequence
MLLHQLVLWLERHPDVTLRAIHIHHGLSPHAESWVRHCETVCARWQVPLVVERVTLADNG
LGIEAHAREARYRAFAQTLLPGEVLATAQHLDDQCETFLLALKRGSGPAGLSAMGERSPF
AGTLLLRPLLRETRKTLEQWAVRHGLCWIEDESNQDDAYDRNFLRLRALPLLQQRWPHFP
AAVARSATLCAEQERLLDELLASDLTDCITTEGTLRLSPLMSMSDVRRAAILRRWLAMRN
APMPSRDALERIWQEVALARDDASPCLRFGDHEIRRYQSQLWWIKSVAGQHETTVAWPVW
QTPLALPAGLGTVQLVPGGELRRPREEESVSIRFKAPGLLHIVGRHGGRKLKKIWQEQGI
PPWRRDTTPLLFYGETLIAAAGVFVTREGAAEDKEGVSLVWHA
Download sequence
Identical sequences 550537.SEN0243 AM933172|CDS_283766-284977 gi|207855754|ref|YP_002242405.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]