SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5518.FG06882.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5518.FG06882.1
Domain Number 1 Region: 964-1131,1164-1272
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.07e-30
Family Carbon-carbon bond hydrolase 0.041
Further Details:      
 
Domain Number 2 Region: 27-77
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000259
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 98-134
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000105
Family Zn2/Cys6 DNA-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5518.FG06882.1
Sequence length 1277
Comment (Gibberella zeae)
Sequence
MSGPSSSTNPPTNPPSIETPAPNPEKGHQLYACGHCGRRYSRPEHLQRHVQTHTLGRRFA
CGICGKTFARADLKKRHETNHENDDSKKRRRTTTALNSGRVTHACKACAAARVKCQEEKP
CQRCTRRGLTCVSSDAGSAAAMNLVHLSASARSNDDEYESGPSTGPSTGPAPTSFPLDQT
SLYGQTVQLQSQPQSRSGTPNTGDLTRSEASSSQQPDADQLPFCDFLRDVLYEQQYDQPA
RMPDNTGLDVLDFCNDTNMELSDMDFGLLDHWNAGGTGPNNPNAILAQVDTPRSDNSADV
AHAHIRQNLVTAWDVSPWRWDPVAKDNAFGEQGNLPVSKKDVASLQAEASQGGLRRVVDQ
RLDFAARDGVLALVLGACQPDAMSSRISGSFPSADLLDTMLHVFLNSHTNQVSEYIHFPT
FKLNEQEPEWIAGAAAAGAVLTPIPTLRKFGYALQEAIRIVMPKRFEENNESILNIGLIH
AIVIGQDTGLWSGNRRKMEIAECHVNIPTTMMRYRGKFQRSTYPMLSVTAADEGANLEQK
WRTWVDMEKWKRFVFHLFLRDSQQSMTALTNPVMSYAELTLPLPASKELWYAKTARDWKH
AYLRREDGHVKRAPSVGDLFRDLNLLAENRHRLDVQLSAAIYLQAYWLLILEYRNLCSSY
RIRSYTQDPYGNTNSLLNARRHQLLQDLQTFKVTTMNWPEITAQERLLLNQLMMALHISI
DDLQLFAGKEGDEQAHRAFHVLQQWVESVDSRAAIWHAGQVLRFAKLFPSAQLKNFYAVG
VHHAALAIWTYGVIKKAGSKQDVSSQHEKIYIDGPESMGIQRYINTGQGLPVFRGPASRN
GVSEATIENPKAGMEAIHEILQANFGGANRMAPAIVENLCVLIRQLGNVAWAVGCSSSLF
DTSTALVATTTVVSTVLFLVVARALLYPVQPKTIRNPLKLGVYDKANADKVKNLVYQPDQ
FPGARDVETPYGSTRVYEFGPEDGEKVLFVHGISTPCITLAPIALALSKRGYRVMLFDLF
GRGFSDGVADIPHDARLYVSQMLLVLASSPLAWTGTNAFRLVGYSLGGGIAIHFANAFPN
LVRDLVLLAPAGLIRAASFGRISRFLFVSGLVPERILAVATRHRLQKPIAASARPSPGAP
VESVTTPPLNVVEAEVNPASGKAATPLEKRVMEYVRWAVTHHQGFVPAFMSSIRFAPLME
QHDAWAKLAQRAPGTTAILLARTDEIINPDDYRRDALSLVGGEQHVRWRILPGSHDFVMT
NPQDILKEIQDMWETKA
Download sequence
Identical sequences 5518.FG06882.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]