SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5518.FG08791.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5518.FG08791.1
Domain Number 1 Region: 106-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000247
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 2 Region: 171-209
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000397
Family Zn2/Cys6 DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5518.FG08791.1
Sequence length 903
Comment (Gibberella zeae)
Sequence
MAATEQNGIDILCDAAGSDMLLSSLFALATPVPVPDQHQRIQPSLHQEQHELQHSLPPSS
PTKHQLFQQQLDPALRQTPGETLQRTPSVLPSKRKLSDASTSSPSHVCHICRRVYERADH
LTRHLRSHENARPYQCTRCPKRFNRADLLTRHETTHDRDGAAKDRPFIRRSDRAAEACLN
CAASKAKCEDQKPCSRCRSKSLACQMPVRRGNQYRTSESQTGMSPSDSSMMASNGGNDSQ
VFTAGDAAYALSQSAIANQEHAIDTTLEYNGTSFISAPSYEDGPEESLYFAMSQKLFPDF
GFSWDVDFGSLKVLLSDTNERSPESRNGGKRFRQSRKEATSEDMPLRRSAWVLDPKTKSQ
AGSLALRSDVVSSHSRDSLFAMVLANNPTPHRVPSFPSAELLNYMIETHIAVEDPKSEGF
IHKSSLDPVTTSLDLISAVVSNGATSVSSPAIWHFGLALHELTSGMIQKLESSTVAARDT
MLLQASMLHVETGQWSGFNRQTAVAESSAPQLLTLLRRTGKTSFTSDTNICTPNTGDPTE
ILESKWRNFITIESCKRLAIRAFLHDVQTSILLWKGPTIAYNELEFALPAAQDLWKAGTP
QVWWDLNSTKGPAPAGDVPRLSDIRDCVSFVTESNAWVDAETCCKAALHGLWGQVWTYRC
AVAPFYNSTSDQSGPDTSLWAHSLYQSLYNDLRRLSAKAKEARTPSPELLLLSELFMMIL
HVSLNDVQRLAGRKGEDESRRAAQLLEKTWLPRPESRYAVWHAGQVLRYAEEYESTRLRG
FNAMVVYFASLTLWAYGLVSQQSTNGYKETGDDMVSLNGPETEELTTFLETGQGTPSVAF
PGGMRSQLEPVSNCAAVLLLGRLIFRQNYPATNEAMPPLVEGLCRHLADLQPGVDGQAAM
KTF
Download sequence
Identical sequences A0MPB6 I1RWV5
XP_011319929.1.100342 5518.FG08791.1 FGSG_08791T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]