SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5518.FG10429.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5518.FG10429.1
Domain Number 1 Region: 69-108
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000000275
Family Zn2/Cys6 DNA-binding domain 0.0023
Further Details:      
 
Domain Number 2 Region: 17-62
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000924
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5518.FG10429.1
Sequence length 637
Comment (Gibberella zeae)
Sequence
MQQISSAEPTPSRHVCHCGKSFIRKEHLRRHQATHGERNFICPMCQRSFTRNDLLRRHLA
RHDMPTAPDPRRGRACDACHANKTKCDGGTKCTLCIKRGISCTYKHASKAGSSRSSRSPV
EDPKRTASRPVPDVHEINTPSSITPPIALGTSQISPADEIKAAFKRISNDVRTGKIPVGE
PTTVPAPDHPWIEANSREYFGRLHEAWPVLHAPSYTIGMEDSFVIATSVAMISCWLRSPD
EYGEVVMELHETIMNTLSQWIDKRLIAKASLLRDAYYALAHFQAPTLFREELDLTMPATF
SLWNAFGLDIFFQRLPFEPTDRSNFKITEICANPNTPAKSLLLLEDVHLALCGLSPAIWN
HAQIVRRSAEAGRSTHNSTASLGWQLEAWKADVERIQHQCFQTFHGAGMGDFPFKAYIGD
FDDKPPRAKAAAMVHVKCLASDCIMIYHLQSLQLYSDTRMINSVAKAHTSPILTDREPTV
RPWLQKLHSQLSLWTKSPESRKAVLHALAVLLDCEAALESNSPQTQSIDPTAYLAISTSA
LVVWAWTLFSEGVCMCVPSLNHINIGVDPPDLQNTNTARLETWIQADGTAAVNNIPLCRC
VINGWTARFNALLPLGKRRWGLCDEVAPILSSLGAGN
Download sequence
Identical sequences 5518.FG10429.1 XP_011319405.1.100342 FGSG_10429T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]