SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 555778.Hneap_0531 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  555778.Hneap_0531
Domain Number 1 Region: 21-253
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.4e-52
Family Extended AAA-ATPase domain 0.000000374
Further Details:      
 
Domain Number 2 Region: 258-331
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.27e-23
Family Helicase DNA-binding domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 555778.Hneap_0531
Sequence length 348
Comment (Halothiobacillus neapolitanus c2)
Sequence
MTDRVITAESVTEDEAIERALRPKRLVDYVGQPAVVEQMEIFIPAARQRGEALDHVLIFG
PPGLGKTTLANIIAHEMGVGLKQTSGPVLERPGDLAALLTNLEPNDVLFIDEIHRLSAVV
EEILYPAMEDHQIDIMIGEGPAARSIKLDLPPFTLVGATTRAGMLTGPLRDRFGIIQRLE
FYSVADLTRIVSRSAQLMGVSIDAGGAQEIAARARGTPRIANRLLRRVRDFAEVRGNGTV
DQPMANAALDLLQVDARGFDQQDRRLLEALIHKFDGGPVGLDNIAAAIGEARDTIEDVLE
PFLIQQGFLVRTARGRMATRQTYAHFGFRPPSAFESQQGTLLPEEEPQ
Download sequence
Identical sequences D0KY62
555778.Hneap_0531 gi|261855149|ref|YP_003262432.1| WP_012823421.1.355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]