SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 555970.Balat_1247 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  555970.Balat_1247
Domain Number 1 Region: 82-230
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.4e-31
Family RecO C-terminal domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 1-79
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.54e-20
Family RecO N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 555970.Balat_1247
Sequence length 239
Comment (Bifidobacterium animalis lactis DSM 10140)
Sequence
MALYRDEAVVLRTAKLGEADRIITLLTRDHGKVRAVAKGVRRTKSRFGARLEPFMRVDLL
LGEGRTFDSVRQAESISAYAGGITGDYATYTAASAMCETAADLLPAEHEPAAAQYRLLIA
ALGALSRHLHDPQAIALSYILRAMSLAGWTIRLDSCVVCGSQDVEFFSASAGGAMCPNDH
TPDAVRVPVHVFDQLRALEQGDWPQLDMLQTPDPRCENIVREWAQYYLERPIRSLRLLD
Download sequence
Identical sequences B8DSY8 D3R6A0
gi|387821140|ref|YP_006301183.1| gi|387822821|ref|YP_006302770.1| gi|384192685|ref|YP_005578432.1| WP_004218580.1.14456 WP_004218580.1.20477 WP_004218580.1.22654 WP_004218580.1.23267 WP_004218580.1.23846 WP_004218580.1.23969 WP_004218580.1.26294 WP_004218580.1.34099 WP_004218580.1.38287 WP_004218580.1.38998 WP_004218580.1.45260 WP_004218580.1.45775 WP_004218580.1.47471 WP_004218580.1.47549 WP_004218580.1.50484 WP_004218580.1.53490 WP_004218580.1.62237 WP_004218580.1.66072 WP_004218580.1.75174 WP_004218580.1.78909 WP_004218580.1.86686 WP_004218580.1.86797 WP_004218580.1.94304 442563.BLA_0825 555970.Balat_1247 580050.Balac_1247 gi|241196677|ref|YP_002970232.1| gi|219683310|ref|YP_002469693.1| gi|384189894|ref|YP_005575642.1| gi|241191271|ref|YP_002968665.1| gi|384194268|ref|YP_005580014.1| gi|518657640|ref|YP_008144002.1| gi|384195833|ref|YP_005581578.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]