SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 557433.LAR_1102 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  557433.LAR_1102
Domain Number 1 Region: 8-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-79
Family Protein kinases, catalytic subunit 0.00000255
Further Details:      
 
Weak hits

Sequence:  557433.LAR_1102
Domain Number - Region: 488-548
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00124
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 
Domain Number - Region: 352-400
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0131
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 557433.LAR_1102
Sequence length 634
Comment (Lactobacillus reuteri F275 Kitasato)
Sequence
MNPGYEIGHRYRIIRSLGEGGMANVYLAHDMVLDRDVSVKLLRLDLRDDPSTKRRFHREA
MAATQLNDPHIVGIYDVGEDHGLQYMVMQYVKGTDLKAYIKKHYPIPLPQVIDIMEQVLS
AVATAHAHGIIHRDLKPQNILIDENKNVKITDFGIAVAVSQDSLTQTNTLMGSVHYLSPE
QARGSIATKQSDIYSLGIILFELLTGKVPFEGETAVSIALKHFREEIPSVREQNKEIPQA
LENVIIKATAKEPAERYSSVNEMAADLKTVLDPERANEPRLKIQQDDNGETKVLDIKHLK
ADDYQPKKSTDSPTVDPSTKPQKWKKYGIVSGTLGMIVLIAVCSWWFLIRQVIIPDVEGM
TVQKAEQRLHQQNLRIGKITLVNSQAVDKNRIVSTNPDVSHKTRVSTPINLTVSTGVKQL
QMADYVGDDYSSVAANLRRKGFQVHQEPVYSDDIDKGQIIRQNHKKGTIVKPAANTIIFR
VSAGKEPIKIPNFKNQDISAVQQFANKNNLQLTTQEKKSKIIATNHVINQTPRAGSTLNH
GDTLTVSIANSGNQTKTTNIQINIPFDGNGGQRENRVQVYIRDANHNLTMEYQDITINQE
TTINVPFTLKQGETGAYRVVRNGRTIMSATNITG
Download sequence
Identical sequences A0A1B7LPV4 A5VKQ2 C0YWI9
557433.LAR_1102 557436.Lreu_1169 WP_003668386.1.2821 WP_003668386.1.3665 WP_003668386.1.48856 WP_003668386.1.8717 WP_003668386.1.97761 WP_003668386.1.9821 WP_003668386.1.9859 gi|148544393|ref|YP_001271763.1| gi|184153757|ref|YP_001842098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]