SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 563041.HPG27_811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  563041.HPG27_811
Domain Number 1 Region: 2-183
Classification Level Classification E-value
Superfamily SIS domain 9.58e-57
Family mono-SIS domain 0.00000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 563041.HPG27_811
Sequence length 188
Comment (Helicobacter pylori G27)
Sequence
MIKKEFLAHKEALEKSLEGLQEALKQSVRLLIETLENQGKILICGNGGSASDAQHFAAEL
TGRYKLERKGLSAISLSTDTSALTAIANDYGYEEVFARQVEALGVKNDVLIGISTSGNSK
NVLKAYEKAKDLGMKTLSLAGRDGGKMKPLSDMALIVPSDDTPRIQEMHILMIHILCDCI
ERHFAHKN
Download sequence
Identical sequences B5Z7L7
gi|208434766|ref|YP_002266432.1| 563041.HPG27_811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]