SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 56780.SYN_03195 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  56780.SYN_03195
Domain Number 1 Region: 270-432
Classification Level Classification E-value
Superfamily TPR-like 1.19e-23
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 56780.SYN_03195
Sequence length 461
Comment (Syntrophus aciditrophicus SB)
Sequence
MIAVVFILSFFLNAAMAQASFTLEDEKKLGKEFYEKLEKSKLLLKNQRINDYVNRVGHLV
LAHSPKAPFEFRFFVINSSAVNAFATPGGYVYVNKGLINLVEKESELAGVLAHEIAHINA
RHIAAIIEKSTRMNIAALAAILAGAFLGGGGEATAALTSFSMAAVTSMNLKYSRDHEEEA
DRLGITYLVGSGYNGKSMLDFLKIMRKYEFYSKSVPSYFLTHPGTDERIRYLDGLLQVRY
RETGKECIVGGLKRIQVYLLFIGNNPELRLTSFQNAIDRNPADVDALYGLALTQERLGLT
DEAIRTFQRALKHAPNDEDIIRDLGIACFRTGQTDDAIRYLSRSLSINRNDENTIIYLGR
AHASAGNFQESLKILKLLENKTSIETDARYHLAMAYGKTGDQGMSHYHFGLFFKENKKKE
SALFHFKAALKYFAQNDPRRHEIEKEIGELEKDKIPKIPGR
Download sequence
Identical sequences Q2LSR1
56780.SYN_03195 gi|85859091|ref|YP_461293.1| WP_011417154.1.90099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]