SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5722.A2E5A1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2E5A1
Domain Number 1 Region: 297-482
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-27
Family cAMP-binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 165-297
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-24
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5722.A2E5A1
Sequence length 542
Comment (Trichomonas vaginalis)
Sequence
MNLRNYETMPRPLSTKNRLPDPAINQLTAYQNQFPEYIPSSNYDKVETRAWSYFSVTRRI
WEYIIFIISILYPVELSFVMIFDRNISVTTYSVFFIFDVVQIADNFVILYTPFLHNGILI
SDKKEILKNYGITFYVIHIIASLPLGWIGIIKGNPNLYLYLSINRLLRLPQCYRSYKLIM
DSTLYNRSYASLIPPIVIISCIIHVFACILYSIGKYADKDESWITQFKDQNYNQIQMYVA
SIYFVLTTILTLGYGDIHPISTPEVIVCIFITIAGVTFQSVLIANMVNALSDPMGTKFLS
QYEAMQRFLKFKGVPDLYKNHIKNYFQGSWERNHGAPSWRALLAPLPKGIQSGIKLEFCQ
RTFSGMPLFYLVGQKYLLLIMNSMQPFTYLPGDIICEQDEEVPDLLIFNHGIIQLILNDV
PLASLNVDSGYVDGERQLMFGKPQDKTIKAVTFVDGWRLRRKDFLDLINSRKMLRTILLA
NARARFPKDFQESPEWDDNQIPATPPSDNSEDSVESEKLEEEFIYVEQSSSSYDSQFTDA
DL
Download sequence
Identical sequences A2E5A1
gi|121907286|gb|EAY12181.1| gi|123485050|ref|XP_001324404.1| XP_001324404.1.43485 5722.A2E5A1 80378.m00178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]