SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5722.A2EJ96 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2EJ96
Domain Number 1 Region: 280-467
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-32
Family cAMP-binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 151-313
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.89e-20
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5722.A2EJ96
Sequence length 566
Comment (Trichomonas vaginalis)
Sequence
MQTLNNNDALSTMVSHYKYATMRYSSNILDKNCRFSHYNRFRRAWEYIMFFLSLMCFAEI
TFVYFIYPQLKFVYYIPFFIPDILFAADHFIIRRTLCISGGEIVDDTEKIKKAYGNFLLI
IHLISIFPLSWIGIIIKYRHVYLILSLNKMLRITRAYTTFMNINNLLPYMGSFATIIPAF
MILLFVTHIFAVIMIIISNAESKPESWTTPYKDRGFTPIMLYITAIYFVLTTVSTVGYGD
ITPETNVEVITIIFVQIIGVIMHTAIIARMISVFVNTLEQSFITQYKVAQDFMKFKKIDN
ERRKEVRNFCQYYWETTGATGGVRNLLRNIPKALRTTIKLEMTRPFFDATVSFNALSPGQ
LAKVAHVIKHITFSPGSYLCKQGEKCNFMLFVGRGIISIIVDDVAIASESCTQSTVHGEN
QMLLGTNCATSIRALTYVDAWVLYQEDLSNLMRHHGYIRNLMMQSIASAYPVMFDDIANH
MLGDIAPKLLLKFRKQNGEVFQNRIPTMRLSESRPRMDMIIQNLSGGETDAGMDSGLRKL
DEKEDEEESSTSSSSSYGNSKVRPFL
Download sequence
Identical sequences A2EJ96
88289.m00141 5722.A2EJ96 gi|121902255|gb|EAY07248.1| gi|123472556|ref|XP_001319471.1| XP_001319471.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]