SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 579137.Metvu_0125 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  579137.Metvu_0125
Domain Number 1 Region: 74-136
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000915
Family NfeD domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 579137.Metvu_0125
Sequence length 138
Comment (Methanocaldococcus vulcanius M7)
Sequence
MEIGYVFILSGFLIIALEVVIPGLYFPAWGIALVVYGVFLLLFPQYAFVSAIVAGFLTVI
CLYKFVYSSGKDIKVGAERFIGMIGRAIEDFKENGYGRIEVENQVWQAKSKDKIKRGDKV
KIVGVEGVSLIVQKVSEG
Download sequence
Identical sequences C9REJ1
gi|261402251|ref|YP_003246475.1| 579137.Metvu_0125 WP_012819539.1.10243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]