SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 583346.CKR_0198 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  583346.CKR_0198
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.71e-37
Family Ribosomal protein L6 0.000031
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.52e-25
Family Ribosomal protein L6 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 583346.CKR_0198
Sequence length 180
Comment (Clostridium kluyveri NBRC 12016)
Sequence
MSRIGKLPIAIPAGVTFTVTPDNVVTVKGSKGQLVKAMAKDINIAVEDNSVVVTRNDDEK
KSRSLHGLTRALINNMVVGVTEGYSKTLELIGVGYRAQLQGKKLVMNLGFSHPVEIEAVE
GVTFETPAATKVVIKGIDKELVGNVAADIRSWRKPEPYKGKGIKYDNEVIRRKEGKTGKK
Download sequence
Identical sequences A5N4R2 B9DYC4
gi|153952876|ref|YP_001393641.1| WP_011988818.1.77168 WP_011988818.1.89246 gi|219853541|ref|YP_002470663.1| 431943.CKL_0239 583346.CKR_0198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]