SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001009096 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001009096
Domain Number 1 Region: 356-543
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.11e-36
Family cAMP-binding domain 0.015
Further Details:      
 
Domain Number 2 Region: 244-373
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-16
Family Voltage-gated potassium channels 0.0044
Further Details:      
 
Weak hits

Sequence:  5911.XP_001009096
Domain Number - Region: 550-596
Classification Level Classification E-value
Superfamily YjbQ-like 0.0732
Family YjbQ-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001009096
Sequence length 913
Comment (Tetrahymena thermophila)
Sequence
MEESIYESLSFREEQDKIKQRISFQMQNIQQKNSVDDMILSKSLDYSISSQFTHLYQDQN
IDSVQNHQEVINKSLTEQQKPQDFQLLNNDDILQMSPFQFSSNRKEVNAISLIDEKNDQT
FQIIKQSQQSNQYGDITKSQQSQQPNQFGDFRKSLFLTPKYNQKSILFQNNPFFTEAYKV
FGKQYQQFLEGKYLFSLVNIFKKEALSLFVKQKQDTLPMQMWDIFSILFTLVSQFESKLQ
ISDSIKNWMKLIKLEILIIILVHVACCNFLKIGLVNEQRGLASWIIKNGFKANSMWELYF
ISLYFIIITICTIGYGDIYPYQLNEKLFIAFLSILATNITAYTFSQISEIVKFESTKNQK
FNDFMTNINHQMKTLGLGMSLSVKVRKHFEFAYYQDEQKKQISDSIVDKLPNNLKNEVLL
DVYQEQINSIKMFKEFSSDCLKNILLSFKQKQLFPDEILVNQNENSENLYFLISGSLEIN
FLIRETKYGKVYEKNVFGYEGFLISKCSPYQLKSIGLSLVSYIDKNSFLQILKQYPEDQN
VFHVENSHTQFKIAHIQVLVQHTSLAIAVQVNNDESLIVDAYNIFLDMLKISEEKQTDDT
QSDYSQSFVNNSKTNYKVQSFIFQSNQAIPQQTTEQQENQNVSLQSLNQTKPISFNSQSL
EQSQIAKTKSQKLGKNNKLDNSEFELNQNRLEHKQVNESNSDYYQKSKETDQQNEDSENK
NTNKSIMITQDVLKDFNDLNQNSEKSKNFHKLVSIDENFSPRHSSNLSKVLNINTFEIQQ
YQNHFSEADINFINEAFQRRKLKIHQHTNAFQKPLTEEATRKKSQHIIYENSKQADGQNQ
QIENCTEFQIRQKIGLQDLDMLVVRKQFMLQYNNYQDKKMVLQLNKLKQLISPKKFKKQK
IKESNINNEKNNS
Download sequence
Identical sequences 23.m00308 5911.XP_001009096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]