SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001009097 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001009097
Domain Number 1 Region: 474-675
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-40
Family cAMP-binding domain 0.027
Further Details:      
 
Domain Number 2 Region: 359-508
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000196
Family Voltage-gated potassium channels 0.0026
Further Details:      
 
Weak hits

Sequence:  5911.XP_001009097
Domain Number - Region: 684-704
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0205
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001009097
Sequence length 1149
Comment (Tetrahymena thermophila)
Sequence
MEDSIYESISFRQEQEKLKERFSFQTQNQQKNYSLEDSILTKNLDYSMISQTSRIQQNQC
ANHQQNQQQARVNSINLLYQQEQHHKDIQFLDNNDILLMSPFQFSSSISKEITPSYQIGG
KIDQNSQLFKQSQYSLQPKQFDDSTKKQFFTPSNKNNMKLGQNNRFLSEIYQPNDFQNMQ
LNQEGASKSQIVSFNYSKKDQLKTQFVLNKFADVKKFVNKLKEKSKRLLFKSISDFQFNI
INDVSSDLDFYLKRKCINQTKILYLVQILLLSQESTYNQKIQEIYENGVSIRDRRQIFKQ
NFNNLMQDFLILIIYSFSTGSYKSKIPFLQNLDYIVFLKYLSIPQKVSEFENKLQISDST
KNWMKLIKLEIIVITLAHVACCIFLKIGLENIQHGQMSWIIKAGFSTESLWNLYLQSLYY
MIVTICTIGYGDISPYQLSTNYEKLYIAFLSVLATNVTAYAFSQISEIVKFESSKNQKFN
HFMTDVNNQMKKIGLGMSLQVKVRKHFEFLYYQDEYKQQISESIVDKLPNSLKNEVLIDI
YQEKINSIKMFKEFSSDCLKNILLSFKQKQLFPDEILLNQQENSENLYFLISGNLEINFQ
IRETKSGKTYEKSKQKIQKSDAFGYEGFLLGKCSQYTLKSIGPSLVSYIDRNIFLQILKQ
YPEDYEKFIFMRDSAIFGQKNEFFKFLKCISCGKFSHQISDCPYLSLNLTYKPSKEKNSR
IQSFQRKRERQRNSLNNLIYFQEKAMAAYANNDESAIIDAYNICLKPISANDEKEIQSEF
SSQSLNNSKNNDKAQSSPQIAEKQIIPFQSLSQKLPRLTSLQNKEQDKLVKELSIKIDES
GQSDQTELKVNQNTLVYDQDKEKLSEFYQKSKETAIFNEESCCYRNSNRSILLTEEVYKD
KLRSSTIDKQYSSQQSGGQFKIQKINTLLIESSQNYFEEPEIYLLKQAFEKRKMRSLQQF
NNFQRSLSDKVYNTKKSFNFNQNKQNILLLDILMSLRDSKLRSQSTQLKNIQNKEYLNSL
IEQLALIHKNRSENEIIDSQKYQNQQIFKQSTKQTEDFNQQIENFTEFSIRQKIGLQDLD
MLVVRKQFMLQQQQNKIQNFIQVPDNEIDIDRMYKNYQDKKQVLLQIKLKILKKQKIKQQ
HKNSSKSDI
Download sequence
Identical sequences 23.m00309 5911.XP_001009097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]