SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001009101 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001009101
Domain Number 1 Region: 499-630,660-704
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.16e-30
Family cAMP-binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 345-459
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000288
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001009101
Sequence length 1272
Comment (Tetrahymena thermophila)
Sequence
MNEDSSNLRQRQETMRKAIKQDGIINEIQQFNGINSDDERILMSFADSLNVNSPQSHYQR
DNDLQIENLQINIQKQDDGNDFEQRFIDLLSPQNRSSLFESEIKLNALKQQQMVQKQNTL
LRRRTTQQAVSEKNQLVCTQKEISIQSISYDSKYGHQNSKQSIKQSEDTQEKNVLKIQQD
NPHKSHKSVDQNFEQLKQYQQNILKVNIPKANFIKTLKISKIFVHKMKMLVRSFLSRNLS
LQAFKIIDDRSSNYEVYIKQQKIASINLQFASQHFLETNQIFNYIRHFLKWVMLTDPKRK
ILILLGFNDETIMGRQFFRKYISRLGAFIKYLDIPKKLSELETKLHFSESTQNWLKLLKL
EIVVLILAHVAACIFLRIGISEANDGLNCWIVQFKVDDNTIWEQYLVSFYYMIISMVTIG
YGDFYPTTLSVIISNIILQALSSKTLFIPFLFMNPLFIKNSYFKIQRTRWGSQRIALLAT
NVCAYSFSQISEIVKFEQAKKENFNQGMINLNQKMKLNGISMTLQQKIRKFFEYHYFSLV
EKKNETDQFVEQLPLKLRQQFCLETNQKLIDSVYIFKILSPQCIQQISSSIKQKYLMPDE
VLLESNSNNDCLYFINKGFLDIYTNFQVDSKSEKVFLKENITGQFIQNYIKEDSSKANLK
ILHRLKNQEVFGYESFLLGEYNQFGLKSYGKTIVSYIDKTSFIDQAIFDTGINSKVKLKC
VSCSSNEHQYLQCPFVIYTTKYKQYSVAMQRQYVKRKKQDKIQVLKTLTLIQEKAMSAYA
QLNDESLIYDAVSFQHMQSFDGKENVDSNSVNSSQTEESENSEDKDTTQLELMSKTISKQ
LQEGFTQSFNQFQSQESEKNKSDSKAKHEQQENTTNQKNMSASIRHFGFQNIKQSLSQDI
QFDLAQNNNNENSAQRKKKSKTYNHQKIKQTNQNQTLNQKQTNQSSSNLDKRYSKTAEFQ
NKEMEQSNSQNREEQKTQQESTKNNQNSSNKDNSKQNKNQNKQNKDSFLENIYARRRRKF
TKFVELQNQLKLNRLAQAKQKENNQKLQDEIIQSKESDQIFNICKQKQLINQLINQNCQK
FQNQQSEKSQSPLIKSFEQLEQLLNQSDLVKQKTHYGSPLLAQSLKSPLIEQEMLKSFAP
HEAMIRCQENVQDLDLLIVRKQYQLLQQQNKNNIENYIELPDNEIDIDQLKEYCFYYPKY
NCRMVLNRVKKMQDKQIKIAKLKDRASISKKSAQTKKKFDKYVLLVNKTKEQCLLLKPFY
LQFSVQKIILFY
Download sequence
Identical sequences 23.m00313 5911.XP_001009101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]