SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001010322 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001010322
Domain Number 1 Region: 458-656
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.02e-41
Family cAMP-binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 391-493
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.29e-22
Family Voltage-gated potassium channels 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001010322
Sequence length 1873
Comment (Tetrahymena thermophila)
Sequence
MTEKLEIIQRIMKRQTQKGSSQRQINLILPMFDHQSDYINRGSTTRRNFLSIENGGEDRN
YSQGAHSPTTLDLRKLNFFDRNSISDGNLGFKKQRKDQKNRDNNENQLSQYLQSSERKKD
KSNADDDEDNSSSQDYSDEKQDVAQEDVQHPQTKERRNGYMIEHKKSKFNDLIFQIRLKN
QVKRLANSINTRMFKNLSHMQYKMIGDNSSDRTYTKHFSYTDNGSSQGDQDYRDRKNSII
TKFMKQIDIFLPAFNPRSILKVYLEILNLVSILLIFFFMSIIISFKMNIDDLVPHIVIEI
SFGLIFVNSFVNLNTGYYEDMKLSKDRQQMFSIYLKTHFYVDISSFISILMLLIFDKTSF
LQASSSDQNAYNVQVSDLDSSWQTKRGCQDDVWFRQYTLAFYYSTVTMTTVGYGDIVPTN
ETETLVAIFMMLFSSGVFGFTLNQIGMIFTEMYSEVKEARRKMKIINIHMEKRKVKHPLR
MQIRQYLDYIWKENSEQIQMESAQIIEQLNDSLKKELQLHQNEKIINYFSKHFSEAFISK
AFSLIKEVQCKPQQLIYKGGSTDNLSLYLIEKGKVEVYYKTKAQKNTPSKHQIIHEIQEG
QLFGITQFYTGLPRDLNIRAIGFVSLLKISRDEFINLLEQFPDDKEAFCYIRDSLIFYQD
GYKSSSQCPSCGSFKHNILNCGYLHYEPNIEKTCLRYNYIPPKQKQIERRKYIRQKDIEE
YANKTTKEETEESFRKRGKLQTRYDLPQHMEQLYLDQFELIEEYEMKYLHYNFDFTFMAS
QKEQKEWAENKDKEEYQDDNVDNNNFISKLQEESSKNIQNINKQLSQSQDQSAMVQYDQV
TDFEKQTSIIQFERENSGSNYSPLQKKNSIVSPTKRGHMREREFSLDQKPKTQVPQVQFK
GPRRLSNQAPVNSPSTRNNQRPKSIIFSDAFEKQYTPSDFSRLSNENKQGLQDNQQTNGN
NINQQNTVTFNLPNGKVATLYRVQEEPILPTLQMQKIVSADQASSYFHQPFITNQINSSH
NIPQPNSSTRNTEKNSTSIKRALSIKMKSFSNHIMKHLEKLIQKNKQPNEIQKALTIDET
DEQYGLTQIFRHFDKQKNFFVYFPLNNLSYLLMKLETKSQIGKKFYLDILQQKKKQPLHQ
NSSQTLFRNKYEKLRIKTDKVQNKGSRGNSMYTSKRTVEQPDHVNVNDQEQAKNNLIHNR
KSAFFEKFQIESPVTSLTDNQFNLLSAKQANNQKLSFNFLKNEVQSQQEIIFDSNPQIYS
SQEPGELSPNSQKNLQESAQLNKHSNFGGTQIFIYVPELYMELGLFSQADKFQNKTFNLQ
KTISFSKHNDIALNFVQEREEPVDFIDIFFDYESKKEDLGIFDDILQNKHQAKKLSPLKQ
KNLSSSYMNNSNSNSMSATIDYISNKSQSFINQLPSSNKNQSTGRQLKSSKLSPLKHDFQ
SPQSRLTNSLSIYQNGSQSFKNLKQSIDAVNSVKQQQQFFNKEFLNEYINKEQQKQQQIY
ESQAQQNGEKGDIDDMYKNPLFKNNLNRLRLQQIEFYPSPPQKSKVNSNHQNQSNHQTSQ
FNEPTQSQMLYDMFDQNHPYSLKQGNNFLKEHFNLQIKNVPDPRKKWVVRKINKQPGNNT
QTSSQQREEKNTKFSQNQSLFTNNENQQLSTQTDESNAFEMVQKSVQGTRDQMIIKSLNP
QFPNKNNFFQTGFDFNQQNNEKNGFINLNNLMISINSPTFYFNQDQFFNQNFSPKTAPSQ
SRKDKAFQIKKFQPQTASLNTKSEYNKAFFKEPVPQNNVLMSKQKQNQLFDDNISNNNQN
IHESSKLQMKLKKQNLASKLFKQENQNSQNDINGFLPFALEQLIDNNPKVLPLYCLNFSR
ALEKRLLLNSLGV
Download sequence
Identical sequences 3757.m00308 5911.XP_001010322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]