SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001010852 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001010852
Domain Number 1 Region: 546-723
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.2e-42
Family cAMP-binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 316-544
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000131
Family Voltage-gated potassium channels 0.0046
Further Details:      
 
Weak hits

Sequence:  5911.XP_001010852
Domain Number - Region: 738-760
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000586
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 
Domain Number - Region: 223-297
Classification Level Classification E-value
Superfamily 4-helical cytokines 0.0394
Family Long-chain cytokines 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001010852
Sequence length 1308
Comment (Tetrahymena thermophila)
Sequence
MAERNTIMNHPSQTDQQYIGISRGLFEDSAMKGLQGDDDHINTSQHNQTTEFEVGKMGST
ENMHMFIESDINATQQQEFNYKIEGQQKHNLSQRVRNNYKKIVLLCKNNNQAVMEKKNNL
NNDALNTSICIQKNYSNTLNIQNTYDDSQQGKQIKFMTMKSTQIPNIPLKQLNGQNNSNK
YQSDFDLTCQKIDSIKDVSKESNYNKYESSEQITTNFIGRKSVLNYQKAANIVNNVISKS
MNRVQRIDKHVKYFVQTLKQKMKNRPLPNLLEAQIQLLNDSSHFHQSRANKKLIHKLLIK
LQDLANLKNPLPVFMPTNDFRVYWDIFQTIFTYSFLYIYSILLFFAFKEKDSGFIKSFFQ
YTFMVFLLDVLINFNTAYFNKDIIITNRKQIIWRYLSSHVFLTDAICLVIMGSKVIMQST
DLVYNPDSKLFPFFVNTLVFLKLNGINPKRERFGYVFTLRESQKHIIRLCNQLLSVVSVA
HAVSLAWYTLGVYENQNGYSTSWLDKYQFSDLSYLEQYIYSMYWSITTMTTVGYGDIAAS
NHVEAFRVRHYLSFLAEEQKDRDQLAENQIFQILSNKLRNEIVIEINSRILKNYSIFSAN
FSTQTLRKLVFIMEEVLISPNEIIFEEGDNDDQSVYLIESGNIEIYQVSPSSQNGSNLNQ
NKTHILQSLNKGSIFGEISFFSGLARKASARSTNLSTLYKINRNQFIELIKENSEDFERF
KMMEEQVKFQQDLSILFVECYTCKSIGHISSQCPIIHQIFDKQFKVLKNNFSIFQNRSVH
IQRLYVCYNIQICQNLKEQIRDYNSYTEIIFKSDIDISQQISEEENEESSENEYNSTSSD
SSLSSNQDQNSMFQQQKEKIVVKKEKSNSQQYEPYKSLKSLKNFKSLKTVQRKNIENQLI
LRDLSPKQKTSNEDFDKFSDISKRESIDKSDKKYEDLKDFLHQRQHSYEQNDQLLDPNSN
LNKSQNSKNQNNSHLTIPSQKDLIPPTSQLDITNETSKKKYNQQINLIYEKSISNEESNS
NSFIEDQAATKQAQIPQQKSTNKLRKGTLKPQKTQRDIRTSIDVLVQNTIYNAFVAQSAA
LTNTQNELNRLESTLSKLEERFSVFNFQNSKSIKSVDSNIVTRRISSQQTPSTLFQKQTN
EYRQSQLGVNNLNNPIKKLSVFKDSQEKKQNSKMSIDVQGIPTQNELRQDTVQNIMLEKI
YKMLDKSNIKDVSNRASYQQDEYSQLYQSATQNVLNKFDMIKNFKKFFPHNNFTYIFNKF
NSKKLLFKTQNCKEIFILQRNNTKAYAIITRLQQLQTNIFIIWSFLKE
Download sequence
Identical sequences 5911.XP_001010852 3812.m02559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]