SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001012020 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001012020
Domain Number 1 Region: 270-302,333-406
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.36e-18
Family Voltage-gated potassium channels 0.0039
Further Details:      
 
Domain Number 2 Region: 402-523
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000017
Family cAMP-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001012020
Sequence length 996
Comment (Tetrahymena thermophila)
Sequence
MIEDSNQDSQTQKSNQCSQGLENSSFLKFSNLRQRKQTHQSDYRVSAQMSPNTALNRNMA
KLKLEKLDGEIKHQIEQDKWKKLEKIMKKLKFKTFIKKFIMLSRKKLFKLLNITQLGLIN
DKASFFDFEKQSRKQQKSIDANQSQFFQNQTNKKEFALWMIFNPNNFYLEIWNLLKLFCT
IICFFFYLVSFSFSVHVVDIVNPIIYFGCQFCLALDILIHLNTAIYVKAILNFAPIFFQQ
IFLLPIVFKYQDLSNMLQKMKNKFISNKQAQKGFELINLIKNILFISHIFSCIWILAAKV
YLPLVQQQTNQTDNQINQQNFTTWIDFMNIQNESWAIQYLYSYYFIIVTMITVGYGDVRP
TNPLEVGVCIILMMTCCLVFGFTINQIGYIFQDMYMKEKNILLKRNRGQYSKFVYYKKLC
RYVWREDLDEHQQEANTILNQLSSNLKQQIQLESNKLVLKENRILKDNFSPQILAEIIPF
IQEQNCTPGEVIIDEQIGNTEGYLYFVQQGEVEQYKNCQQTQIYLKNKKQSIVSIKKILQ
CSSCHERNHTEIQCPILHYIPKKFKVLQENTINTPHLVRQTQFNRKIAQKRNTFQDLENN
VYRGLQFIEEKGEDLDEFENEYLEFSFFQKNQLYNSDLEQNQEKVLVYSQKVKSMYQRNQ
TSKEENDKYSKRKSRIYSFVSNHLIKQKTLDEENIQSAKSIQNKSENENENEINLEQENF
RKKMHKKFMNTMSVIYQSSKLIQEHEEQSESNNYSKQTIGQIQRPSFIMNQSIKDIQIQE
KCTKNQKVSDLSLQPYSNKNEIDTEFNTHFDIFFGQFESLQNYKYYFPQQNYKEVLNKLN
DIIINQVNARGINMKNFLKNENGISSFKRRNNVFNFIKKKIYDSQLLQAVDSQNQNINGN
NPDLEAQQNFTLQDTQFKPQSLSVESENKTTISKIQQSYNLNGLTAQAMNDISTNALNNS
IKVDLDTPELEDEQQDFRVLPLVSYPRRSYFYDSNN
Download sequence
Identical sequences 137.m00109 5911.XP_001012020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]