SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001012604 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001012604
Domain Number 1 Region: 451-646
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-42
Family cAMP-binding domain 0.0011
Further Details:      
 
Domain Number 2 Region: 318-487
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-19
Family Voltage-gated potassium channels 0.0028
Further Details:      
 
Weak hits

Sequence:  5911.XP_001012604
Domain Number - Region: 653-679
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000165
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001012604
Sequence length 1426
Comment (Tetrahymena thermophila)
Sequence
MDFNITNDDASLSVHMNSIQFNIKDHQDLQKMNKRQSETLSYCTSEDLKTEELTQTKYKI
QKNQSDTQNDDFLLNPNKEESSYQNSLFKVQFTTVDNKEQSRKEEDYDDQEKKLKYLITD
KSKSKGKYFSKENSQYYDNEGKQKMDSSPNLDNIQKNYPTRLIKAINLLVNVKSFYRLLT
KNTRILGKLTNKQHYLINDATSVYYILMESNNQSLLYHFPKLKQVFLVTFFQMSTIQFIT
FFQVVFILFVLDMLLTFNTAILEKGEVIFDRKKAAITYLKRNFIMDQIALLPLFMFFFNI
QLQGLYSWAIYFQILMKLYVLSDIFDRLTYYLNYQKNMKNIVDIVKLIFIIGCVCHVFCL
FWHGLAIYEIKQGCKNTWLQVRGIQDEDVFTRYVQSFYYLAVTMITVGYGDITPQTTYEI
IFSTVTMFVTGFFYAFSLNKIGIIIDNLEMKDKSYKQSMQIIHRLMRQEKVSQALRVQIS
NYLQYLYKESDEIAKQQESDIINKLSKKLKSDLVQEVQGKYLKDIEFIDKLQTKFKIVES
MEECLFSPGEYIFRQGEIDDCALYYIVKGSVHITYEYQDGNQTRSLILAELKKSQYFGEM
QFIQGNQRIMTAQASDFCRTYKIPKDSFFQSLKESDQDYENFQMLKEAFTFKENQKLFKI
KCYICNKTDHFSIKCPKIHLTLSKQTMIQKTNNSVPHIERTKKERKRERFHSLEKNFETT
DAIFQFLQKEENLTQLQQLEEELHLSQDEAFIEECLQELKDLEKAQELQNLENSLVKQDK
FDSNPQRIKEEQQEEEDNDSQDNDNNKNQNVSIQDQNKVKMQNRNSSFGEIKNQQEIPIQ
QFQRNQSIKMSKKNEAIPDQQYLNQQFSVTSSKNSISQYQIIYGDQRSSSLCNSKKSCTL
QKTSSLSQSLNEQINQTRSKIQTSSSPKANIILQQPNEGGLKNSSFDQRVRQINNENSNQ
QQKSSDNKHSFLSTASQQINYSNNENHELEKQPNIKTFLHRKSFSLSILEENETQQQKQI
NQSQFKPQMNQKQKEGYQVDSTEQPQNEQNLINKPYHSKDIQQNEKQNIPNRIRKSKSFD
ESFYQQIKDQLELDKIPKQYNQINDRDSNQIKLLQKLEKLNSFKQNQYQKTNTLSLYTKN
RSKQGSVNSYLGSLASLNSNEINFEIPQNQQNSISNRRKSKRLTILRQMMQQKRQSLISS
PAVQLQIINQIQNQQIKNQTFDINQADSNLQFSNKFNNENTQNYPSRNSGIVQQVNQNRG
SINTIQNYLSQAFLQPHFQPLNNQRNSHIMNKNLNKSPHQDFNKSRLSNTQLFGNLDLNN
KLVETLTDINMRENTKKTLLASELQLPIDNNLLYQAEILEQDQDYSQQSGDSSYYMLQLF
EKFKIYKYYYPNCNIELGIIKQIKTIYKAETIITKHTSKQKNEQIQ
Download sequence
Identical sequences 5911.XP_001012604 3836.m01975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]