SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001012954 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001012954
Domain Number 1 Region: 324-492
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-35
Family cAMP-binding domain 0.0072
Further Details:      
 
Domain Number 2 Region: 79-310
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-22
Family Voltage-gated potassium channels 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001012954
Sequence length 1223
Comment (Tetrahymena thermophila)
Sequence
MSKQLIGQKNLQNGQKSQILQKAIFEASLEEKIKIFQKYNLDLLNNDYIDKKNQQRNNIF
LFRTVDIVWRVLDYFPVFNPYNKCVIAWDVLQILAVFNLLFIYPLIFVIEAAFNNRYEYF
CSIIVLIDMIIRLNIGFFDMDTFIICKKKIFQHYLKHGLPFDILGNVSIVYYLFFPQHDQ
PLLLLILSKLYMIRKLLINVEETYFHNFQLRNYMKLLKLICTLIFFAHLFACGWIYVGNL
GFPNNWIQKAGLQNDNWQSVYLKSIYYALVTMITVGYGDITPQNYSETIFVSFIMVLACG
IFGYSLNQIGVVKREYCNNQHLYEEEENINSPLIQNKAVPLLEIKQILSQQLQSELVWDE
NKLILREARILVDNFSEEVMRKTASIIRHINYTPEEIIFQEGDSDNKNLYFVEKGSCEIF
IEGNDKKQTLYEIQSGQYFGTTSFFTGLNRTCSIRSQGFSTLLFINRDDFIDICKQSAPD
FEKFCYLRDKVLYENDFSFINSQCYCCHQKQQKQNTNFDKIMYNTKTSQAIYEGKLILTI
IADMYNSEDYEEDDSMILLNEESPVFTVTNIANDEVNTIKSNQRRNNFDQEESSKYFQKS
FSLNQNQQLQHQNKFQQMNQQEYQKSQSYNIQSDDHVSKNNINVNFFTAAEPNYMQTQST
DRGRFESFLSNKFRQGEDGLAQKRVSFNEEIVDQKRVSSYEATIDQKSMPIISTILAINN
SNITNNNQAYSLTKVVKSNMQPSESNYADRSSITLSKIEVRSRNNSALSNVSCQSPLTKK
SQLFFNKISNNFIEQNLEQEVNNKQLEQNSFIHQEERQYNLDQNELQFQQSLSSIVSKNQ
KDKLVKESSQSSSQIQKLLPSKQSSQIYATQSKSSGTNVLTTLLKVKNITKKIKNKFENA
KKNLQELQNQQSSNDKSAKYSELKTFVSEKKQNQNYGINFELISQHSQMFFFLMKHRNIV
TYSTTQQILDEQFEKMELINSYKTIVIIIKRQELSKIEYKNDNSRNVNSISRLKNKFQKE
QNSVNTFNKFNNYDVDDSKSQTFQEIFKDIDGDSYSKILNQNNHNLKQHFSQIVNQNPKR
RKTTATNKIDQSSQDVEMPTPKLQSQINSINQMSINLGSPIFNYNQKRQSQGSPFVFSKQ
IALNQIPQTNQAYINTGLIEKPQLTTKTKYQITTIKEVDQQINDMDNDINSNSIIPDPQN
SFNITIPNLQVNNQQFKEYLDDL
Download sequence
Identical sequences 5911.XP_001012954 32.m00216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]