SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001014256 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001014256
Domain Number 1 Region: 372-572
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.73e-43
Family cAMP-binding domain 0.0011
Further Details:      
 
Domain Number 2 Region: 319-367
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000001
Family Voltage-gated potassium channels 0.0051
Further Details:      
 
Weak hits

Sequence:  5911.XP_001014256
Domain Number - Region: 575-599
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0034
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001014256
Sequence length 1089
Comment (Tetrahymena thermophila)
Sequence
MQNNSQTHLKFEQNRLGTSTSFDNHMVQLKFNSQDHDELNEINKKKHDTEIMDQSCRREQ
QIRFKDEQKHDEIQISIFDQSIANNECLETSIKPIDKEKKKTLAQLRIQRIKFSRQLSQD
QLNFQKEENINKSTQQLSQFVNKDLKSKKEPLKIMLALNLLVSVKSFYRQVTKNTRIFQR
LTEEQHEIIGDVVSVYHKNSTIKSKRIQQFLTYFNYILYSKIPDLPTFSPNGLLKTIWDL
LNAFLIVALSFIMSLQLFFTLEANEFITQGMLLILENQSFYSVQFAMYSVDFGTTQQFMK
FNKDMIKLGCINIILKKHLFLLAVTMITVGYGDITPQNSTEIIFTILTMFVTGMTWGFSI
SKIGNIIDNIEKKEKSYKESMQVIHTLMREENIRSDFRDQISNYLKYIYNESNEVQKQQE
QKVIEKLSNQLRFQLISEIQGQYLENIPFIKNMELKQKIIFLMEECLYSPGEIIFQENNI
DDCALFYIVKGEVEIIRQSISRNREDSIIQVLQKSSYFGEISFITGQIRNLTAKAADFCR
IYKINREKFLNLIRESNRDYEEYVMIRDNIIFKNNYSIINQKCFHCQSEEHFSMSCPKTH
LIISKKGIAHRYCFSVPHLKRQIFSRRNKQLKWKTRISQKRLYQAVYQINDNEDFFEVLN
EIEQQAKPNKSLIYENDDTFQSSECSQEEDNKHEDQNKIQRRSGLRKVKIKETNETIQEI
QPSNTNISNQSSYSSLNNKNNADSSQQNENQMSNSIVFQEQIRSIQKEISNIQNILQGED
GSLNKLTSIKESCQYIPSQCKIQDKQLPSSFISQQYSRKDRKSLSVGLCHQQDINEQNIL
QFNQQQQQLNLQQQQQQNYNQQLQQQNYHQLPDSQKISNELNSLLSLHEPIKNQISQLSQ
FNERQLSDSPQSNKYLKHSILKIKTRSISRLDNNLEQKDQSRQNSHSSKMQDLNQQDSLD
QVVKGKKKQRRQSNSSCKNTQYNRQDSLYKIGNTPYQTQIKLPQLNNEKHQNIENSYFML
QHFDKGQVFKYYYPKHNYTKILKLLKKMQVSITVEKNIKNRKMIKQLSKKQEFKSSSFSP
FAKFQKQND
Download sequence
Identical sequences 19.m00327 5911.XP_001014256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]