SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001015087 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001015087
Domain Number 1 Region: 534-732
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-47
Family cAMP-binding domain 0.0023
Further Details:      
 
Domain Number 2 Region: 407-527
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000196
Family Voltage-gated potassium channels 0.0049
Further Details:      
 
Weak hits

Sequence:  5911.XP_001015087
Domain Number - Region: 741-759
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0502
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001015087
Sequence length 1130
Comment (Tetrahymena thermophila)
Sequence
MDLNKLSTIIENNTESEFLAKKEQQSANIFERSCQKWIIDDRSEQIKQGLQGDSGLKVIS
SFEDVIQNANSKIKQKVQIDNNNINELDKSQFYQFNITCSKQNNMSIFNINDNEENSSSE
NQQKKVEDQKQQVLNNQNEIQVNICSATRNKQNSKYDEHLKQNTRRNTQVIQTMSRQRDK
TCSLYINQSQFNQQKIKKANQLYTMVNVKLKVLEFVKKMKLIYKNRKLDNLSKFQIEVIS
DSCYYFEKDLSQKHSIFFNLFKRTKKLIQHIPILIPTNKIIILFDLLGIIYFYLFFFFFS
IFAFFNQAELNSNQFAFTCLLSVVLMLLDILESFNMAVFRRDIIILEREFIIKSYLLSFH
FLTDFVSLIALFSEIVSNPNQITFNPENNIWKYIQIVIVFVKLYGVKQKIQRIKNVITLS
QNQKHFYKLVSQIFSVLQIAHISCIGWYSLTFIQENERNWLQKINLENSAYHIKYIYSFY
WAIITMSTVGYGDIVATNYSEALYISINTIIFSCVFAFSINNIGQILHDIQMSHQNIKNQ
TQVIEKYLKRKNVNIQLKTRVIQYLFFLEEEINSKLLKEEEQVLSILSLKLREEIIQEAN
SQILKKFNIFNCFSQQSINKLVFQMKEIIVSPGEVIFSEGDRDDSIYLITSGQIQILQNT
AQKSCSIFQLKTLSENQIFGEIAFFSQMPRTATAKSLNLSTLYKIERKDFIEIVQQNQMD
FEVFKSIQHQILLNYDFKQIQTKCYSCNSSNHIIQKCPIVHQAFDCQLINLKNNYHTQQV
RQKFNRQNIRIYQAKKYSSKISVQILQFMKTQIILKQKRNLAGLNIQIQNQLKMDLEYQN
FFNSELELSQQFASNIQMEESKLHGYQQYINPTKNQSQNVANKVLGDLSLRNNTINEGIQ
FEKEQDFQQGLGQDEVSFSHFHSLGDICNKNDGISSNSKISIHKNNIQVDKIQSCSTNQF
EQESINLSANLITESHYSQDQKFHKYLPSYASLQLYPEDKKNKIISSKTQENKIIKLCKD
ELQNDLKNEQSQQSQLSMMTTSSNGKREKTTSLGRKSQLQKVLKTHDGDQQQTMLGTQTS
KQQNDNDKLKPRLSPRSRYIFMKKQQKNKICYGVSTKSCNKNPKVFDKNI
Download sequence
Identical sequences 3827.m00941 5911.XP_001015087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]